VPS37A anticorps

N° du produit ABIN631404

Détail du produit anti-VPS37A anticorps

Antigène: VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS37A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS37 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS37A Blocking Peptide, catalog no. 33R-8941, is also available for use as a blocking control in assays to test for specificity of this VPS37A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS37A

Antigène: VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))

Autre désignation: VPS37A (VPS37A Produits)

Synonymes: anticorps fb08f03, anticorps fj42c03, anticorps zgc:73244, anticorps zgc:77637, anticorps wu:fb08f03, anticorps wu:fj42c03, anticorps HCRP1, anticorps PQBP2, anticorps SPG53, anticorps 2210018P21Rik, anticorps 4930592A21Rik, anticorps AW261445, anticorps D8Ertd531e, anticorps vacuolar protein sorting 37A, anticorps VPS37A, ESCRT-I subunit, anticorps vacuolar protein sorting 37 homolog A, anticorps vacuolar protein sorting 37 homolog A L homeolog, anticorps vps37a, anticorps VPS37A, anticorps vps37a.L, anticorps Vps37a

Sujet: VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.

Poids moléculaire: 44 kDa (MW of target protein)