LDLRAP1 anticorps (N-Term)
-
- Antigène Voir toutes LDLRAP1 Anticorps
- LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LDLRAP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LDLRAP1 antibody was raised against the N terminal of LDLRAP1
- Purification
- Affinity purified
- Immunogène
- LDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK
- Top Product
- Discover our top product LDLRAP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LDLRAP1 Blocking Peptide, catalog no. 33R-10023, is also available for use as a blocking control in assays to test for specificity of this LDLRAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDLRAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." dans: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
: "
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." dans: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
-
- Antigène
- LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))
- Autre désignation
- LDLRAP1 (LDLRAP1 Produits)
- Synonymes
- anticorps ARH, anticorps ARH1, anticorps ARH2, anticorps FHCB1, anticorps FHCB2, anticorps AA691260, anticorps Arh, anticorps Arh1, anticorps RGD1563417, anticorps arh, anticorps arh1, anticorps arh2, anticorps fhcb1, anticorps fhcb2, anticorps xptb, anticorps LDLRAP1, anticorps ldlrap1, anticorps sb:cb50, anticorps zgc:56121, anticorps zgc:158745, anticorps low density lipoprotein receptor adaptor protein 1, anticorps low density lipoprotein receptor adaptor protein 1 L homeolog, anticorps low density lipoprotein receptor adaptor protein 1 S homeolog, anticorps low density lipoprotein receptor adaptor protein 1a, anticorps low density lipoprotein receptor adaptor protein 1b, anticorps LDLRAP1, anticorps Ldlrap1, anticorps ldlrap1, anticorps ldlrap1.L, anticorps ldlrap1.S, anticorps ldlrap1a, anticorps ldlrap1b
- Sujet
- LDLRAP1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). LDLRAP1 may be required for LDL binding and internalization but not for receptor clustering in coated pits. LDLRAP1 may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-