ATP6V0E2 anticorps (Middle Region)

N° du produit ABIN631416

Détail du produit anti-ATP6V0E2 anticorps

Antigène: ATP6V0E2 (ATPase, H+ Transporting V0 Subunit E2 (ATP6V0E2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V0E2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2

Purification: Affinity purified

Immunogène: ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V0E2 Blocking Peptide, catalog no. 33R-9342, is also available for use as a blocking control in assays to test for specificity of this ATP6V0E2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V0E2

Antigène: ATP6V0E2 (ATPase, H+ Transporting V0 Subunit E2 (ATP6V0E2))

Autre désignation: ATP6V0E2 (ATP6V0E2 Produits)

Synonymes: anticorps ATP6V0E2L, anticorps C7orf32, anticorps 0610006O14Rik, anticorps NM9.2, anticorps atp6v0e2, anticorps atp6v0e2a, anticorps atp6v0e2l, anticorps ATPase H+ transporting V0 subunit e2, anticorps ATPase, H+ transporting, lysosomal V0 subunit E2, anticorps ATPase, H+ transporting V0 subunit e2, anticorps ATPase, H+ transporting V0 subunit e2 S homeolog, anticorps ATP6V0E2, anticorps Atp6v0e2, anticorps atp6v0e2.S

Sujet: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport