ACD anticorps

N° du produit ABIN631477

Détail du produit anti-ACD anticorps

Antigène: ACD (Adrenocortical Dysplasia Homolog (ACD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACD est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACD Blocking Peptide, catalog no. 33R-4573, is also available for use as a blocking control in assays to test for specificity of this ACD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACD

Antigène: ACD (Adrenocortical Dysplasia Homolog (ACD))

Autre désignation: ACD (ACD Produits)

Synonymes: anticorps PIP1, anticorps PTOP, anticorps TINT1, anticorps TPP1, anticorps ACD, anticorps ACD, shelterin complex subunit and telomerase recruitment factor, anticorps adrenocortical dysplasia, anticorps ACD, anticorps Acd

Sujet: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance