POLR2K anticorps (Middle Region)

N° du produit ABIN631534

Détail du produit anti-POLR2K anticorps

Antigène: POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR2K est non-conjugé

Application: Western Blotting (WB)

Specificité: POLR2 K antibody was raised against the middle region of POLR2

Purification: Affinity purified

Immunogène: POLR2 K antibody was raised using the middle region of POLR2 corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR2K Blocking Peptide, catalog no. 33R-2205, is also available for use as a blocking control in assays to test for specificity of this POLR2K antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR2K

Antigène: POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))

Autre désignation: POLR2K (POLR2K Produits)

Synonymes: anticorps ABC10-alpha, anticorps RPABC4, anticorps RPB10alpha, anticorps RPB12, anticorps RPB7.0, anticorps hRPB7.0, anticorps hsRPB10a, anticorps MafY, anticorps Mt1a, anticorps rpb12, anticorps rpabc4, anticorps rpb7.0, anticorps hrpb7.0, anticorps hsrpb10a, anticorps rpb10alpha, anticorps abc10-alpha, anticorps POLR2K, anticorps polr2ka, anticorps polr2kb, anticorps zgc:171795, anticorps RNA polymerase II subunit K, anticorps polymerase (RNA) II (DNA directed) polypeptide K, anticorps polymerase (RNA) II subunit K, anticorps polymerase (RNA) II subunit K L homeolog, anticorps polymerase (RNA) II subunit K S homeolog, anticorps POLR2K, anticorps Polr2k, anticorps polr2k, anticorps polr2k.L, anticorps polr2k.S

Sujet: POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.

Poids moléculaire: 7 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways