POLR3F anticorps (N-Term)

N° du produit ABIN631535

Détail du produit anti-POLR3F anticorps

Antigène: POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR3F est non-conjugé

Application: Western Blotting (WB)

Specificité: POLR3 F antibody was raised against the N terminal of POLR3

Purification: Affinity purified

Immunogène: POLR3 F antibody was raised using the N terminal of POLR3 corresponding to a region with amino acids MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR3F Blocking Peptide, catalog no. 33R-5647, is also available for use as a blocking control in assays to test for specificity of this POLR3F antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR3F

Antigène: POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))

Autre désignation: POLR3F (POLR3F Produits)

Synonymes: anticorps 2810411G20Rik, anticorps 3010019O03Rik, anticorps 3110032A07Rik, anticorps RPC39, anticorps RPC6, anticorps zgc:56299, anticorps zgc:76983, anticorps RNA polymerase III subunit F, anticorps polymerase (RNA) III (DNA directed) polypeptide F, anticorps POLR3F, anticorps Polr3f, anticorps polr3f

Sujet: POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Poids moléculaire: 36 kDa (MW of target protein)