BBS5 anticorps (Middle Region)
-
- Antigène Voir toutes BBS5 Anticorps
- BBS5 (Bardet-Biedl Syndrome 5 (BBS5))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BBS5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BBS5 antibody was raised against the middle region of BBS5
- Purification
- Affinity purified
- Immunogène
- BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
- Top Product
- Discover our top product BBS5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BBS5 Blocking Peptide, catalog no. 33R-9497, is also available for use as a blocking control in assays to test for specificity of this BBS5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BBS5 (Bardet-Biedl Syndrome 5 (BBS5))
- Autre désignation
- BBS5 (BBS5 Produits)
- Synonymes
- anticorps zgc:56578, anticorps 1700049I01Rik, anticorps 2700023J09Rik, anticorps Bardet-Biedl syndrome 5, anticorps Bardet-Biedl syndrome 5 (human), anticorps bbs5, anticorps BBS5, anticorps Bbs5
- Sujet
- BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog
-