PTGR2 anticorps (Middle Region)
-
- Antigène Voir toutes PTGR2 Anticorps
- PTGR2 (Prostaglandin Reductase 2 (PTGR2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTGR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZADH1 antibody was raised against the middle region of Zadh1
- Purification
- Affinity purified
- Immunogène
- ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
- Top Product
- Discover our top product PTGR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZADH1 Blocking Peptide, catalog no. 33R-4040, is also available for use as a blocking control in assays to test for specificity of this ZADH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTGR2 (Prostaglandin Reductase 2 (PTGR2))
- Autre désignation
- ZADH1 (PTGR2 Produits)
- Synonymes
- anticorps ZADH1, anticorps MGC146252, anticorps PGR2, anticorps 1810016I24Rik, anticorps 9130222H03Rik, anticorps 9630002F03Rik, anticorps AI838763, anticorps B830026H24Rik, anticorps PGR-2, anticorps PRG-2, anticorps Zadh1, anticorps prostaglandin reductase 2, anticorps prostaglandin reductase 2 S homeolog, anticorps PTGR2, anticorps ptgr2, anticorps ptgr2.S, anticorps Ptgr2
- Sujet
- ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
- Poids moléculaire
- 38 kDa (MW of target protein)
-