ATP6V1B1 anticorps (Middle Region)
-
- Antigène Voir toutes ATP6V1B1 Anticorps
- ATP6V1B1 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B1 (ATP6V1B1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP6V1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP6 V6 1 antibody was raised against the middle region of ATP6 6 1
- Purification
- Affinity purified
- Immunogène
- ATP6 V6 1 antibody was raised using the middle region of ATP6 6 1 corresponding to a region with amino acids LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL
- Top Product
- Discover our top product ATP6V1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP6V1B1 Blocking Peptide, catalog no. 33R-5204, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP6V1B1 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B1 (ATP6V1B1))
- Autre désignation
- ATP6V1B1 (ATP6V1B1 Produits)
- Synonymes
- anticorps ATP6B1, anticorps RTA1B, anticorps VATB, anticorps VMA2, anticorps VPP3, anticorps AW208839, anticorps Atp6b1, anticorps D630003L15, anticorps D630030L16Rik, anticorps D630039P21Rik, anticorps Vpp-3, anticorps Vpp3, anticorps ATPase H+ transporting V1 subunit B1, anticorps ATPase, H+ transporting, lysosomal V1 subunit B1, anticorps ATP6V1B1, anticorps Atp6v1b1
- Sujet
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Proton Transport
-