ARPC2 anticorps (N-Term)
-
- Antigène Voir toutes ARPC2 Anticorps
- ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARPC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARPC2 antibody was raised against the N terminal of ARPC2
- Purification
- Affinity purified
- Immunogène
- ARPC2 antibody was raised using the N terminal of ARPC2 corresponding to a region with amino acids MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL
- Top Product
- Discover our top product ARPC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARPC2 Blocking Peptide, catalog no. 33R-6593, is also available for use as a blocking control in assays to test for specificity of this ARPC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))
- Autre désignation
- ARPC2 (ARPC2 Produits)
- Synonymes
- anticorps arc34, anticorps p34-arc, anticorps pnas-139, anticorps pro2446, anticorps Arpc2, anticorps Arc-p34, anticorps 2210023N03Rik, anticorps 34kDa, anticorps p34-Arc, anticorps fk84a07, anticorps wu:fa22f07, anticorps wu:fk84a07, anticorps zgc:77769, anticorps ARC34, anticorps PNAS-139, anticorps actin related protein 2/3 complex subunit 2, anticorps actin related protein 2/3 complex, subunit 2, 34kDa, anticorps actin related protein 2/3 complex, subunit 2, anticorps actin related protein 2/3 complex subunit 2 S homeolog, anticorps ARPC2, anticorps arpc2, anticorps Arpc2, anticorps arpc2.S
- Sujet
- ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Regulation of Actin Filament Polymerization
-