RNF6 anticorps
-
- Antigène Voir toutes RNF6 Anticorps
- RNF6 (RING Finger Protein 6 (RNF6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE
- Top Product
- Discover our top product RNF6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF6 Blocking Peptide, catalog no. 33R-9514, is also available for use as a blocking control in assays to test for specificity of this RNF6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF6 (RING Finger Protein 6 (RNF6))
- Autre désignation
- RNF6 (RNF6 Produits)
- Synonymes
- anticorps 1200013I08Rik, anticorps 5730419H05Rik, anticorps AA537053, anticorps ring finger protein 6, anticorps ring finger protein (C3H2C3 type) 6, anticorps RNF6, anticorps Rnf6
- Sujet
- RNF6 contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation.
- Poids moléculaire
- 78 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Cell Size
-