RNF6 anticorps

N° du produit ABIN631636

Détail du produit anti-RNF6 anticorps

Antigène: RNF6 (RING Finger Protein 6 (RNF6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF6 Blocking Peptide, catalog no. 33R-9514, is also available for use as a blocking control in assays to test for specificity of this RNF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF6

Antigène: RNF6 (RING Finger Protein 6 (RNF6))

Autre désignation: RNF6 (RNF6 Produits)

Synonymes: anticorps 1200013I08Rik, anticorps 5730419H05Rik, anticorps AA537053, anticorps ring finger protein 6, anticorps ring finger protein (C3H2C3 type) 6, anticorps RNF6, anticorps Rnf6

Sujet: RNF6 contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Cell Size