ARPC3 anticorps (N-Term)

N° du produit ABIN631647

Détail du produit anti-ARPC3 anticorps

Antigène: ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARPC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARPC3 antibody was raised against the N terminal of ARPC3

Purification: Affinity purified

Immunogène: ARPC3 antibody was raised using the N terminal of ARPC3 corresponding to a region with amino acids MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARPC3 Blocking Peptide, catalog no. 33R-6271, is also available for use as a blocking control in assays to test for specificity of this ARPC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARPC3

Antigène: ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))

Autre désignation: ARPC3 (ARPC3 Produits)

Synonymes: anticorps ARC21, anticorps p21-Arc, anticorps 1110006A04Rik, anticorps 21kDa, anticorps AA408672, anticorps AI788639, anticorps p21-Ar, anticorps p21Arc, anticorps arc21, anticorps p21-arc, anticorps zgc:86828, anticorps actin related protein 2/3 complex subunit 3, anticorps actin related protein 2/3 complex, subunit 3, anticorps actin related protein 2/3 complex subunit 3 L homeolog, anticorps actin related protein 2/3 complex, subunit 3, 21kDa, anticorps actin related protein 2/3 complex subunit 3 pseudogene, anticorps actin-related protein 2/3 complex subunit 3, anticorps actin-related protein 2/3 complex subunit 3 pseudogene, anticorps ARPC3, anticorps Arpc3, anticorps arpc3.L, anticorps LOC738738, anticorps arpc3, anticorps LOC100036831, anticorps LOC100341254

Sujet: ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Signalisation RTK, Regulation of Actin Filament Polymerization