CEACAM6 anticorps

N° du produit ABIN631672

Détail du produit anti-CEACAM6 anticorps

Antigène: CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEACAM6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CEACAM6 Blocking Peptide, catalog no. 33R-4544, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CEACAM6

Antigène: CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))

Autre désignation: CEACAM6 (CEACAM6 Produits)

Synonymes: anticorps CD66c, anticorps CEAL, anticorps NCA, anticorps carcinoembryonic antigen-related cell adhesion molecule 6, anticorps carcinoembryonic antigen related cell adhesion molecule 6, anticorps Ceacam6, anticorps CEACAM6

Sujet: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.

Poids moléculaire: 33 kDa (MW of target protein)