NR4A3 anticorps (Middle Region)

N° du produit ABIN631676

Détail du produit anti-NR4A3 anticorps

Antigène: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR4A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR4 A3 antibody was raised against the middle region of NR4 3

Purification: Affinity purified

Immunogène: NR4 A3 antibody was raised using the middle region of NR4 3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR4A3 Blocking Peptide, catalog no. 33R-4272, is also available for use as a blocking control in assays to test for specificity of this NR4A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR4A3

Antigène: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Autre désignation: NR4A3 (NR4A3 Produits)

Synonymes: anticorps CHN, anticorps CSMF, anticorps MINOR, anticorps NOR1, anticorps TEC, anticorps AI573420, anticorps NOR-1, anticorps Nor1, anticorps NOR-2, anticorps NR4A3, anticorps Nr4a3, anticorps nuclear receptor subfamily 4 group A member 3, anticorps nuclear receptor subfamily 4, group A, member 3, anticorps NR4A3, anticorps Nr4a3, anticorps nr4a3

Sujet: NR4A3 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. NR4A3 may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between NR4A3 gene and other genes.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway