GRK4 anticorps (Middle Region)

N° du produit ABIN631696

Détail du produit anti-GRK4 anticorps

Antigène: GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: GRK4 antibody was raised against the middle region of GRK4

Purification: Affinity purified

Immunogène: GRK4 antibody was raised using the middle region of GRK4 corresponding to a region with amino acids QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRK4 Blocking Peptide, catalog no. 33R-7734, is also available for use as a blocking control in assays to test for specificity of this GRK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRK4

Antigène: GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))

Autre désignation: GRK4 (GRK4 Produits)

Synonymes: anticorps GPRK2L, anticorps GPRK4, anticorps GRK4a, anticorps IT11, anticorps A830025H08Rik, anticorps GRK, anticorps Gprk2l, anticorps Gprk4, anticorps AMPK, anticorps AMPKalpha, anticorps CG3051, anticorps DmAMPK alpha, anticorps Dmel\\CG3051, anticorps EG:132E8.2, anticorps FBgn0023169, anticorps Gprk-4, anticorps ampk, anticorps ampkalpha, anticorps dAMPKa, anticorps dAMPKalpha, anticorps snf1a, anticorps gprk4, anticorps gprk4-a, anticorps grk4, anticorps GRK4, anticorps gprk4-b, anticorps zgc:153020, anticorps gprk2l, anticorps grk4a, anticorps it11, anticorps G protein-coupled receptor kinase 4, anticorps AMP-activated protein kinase alpha subunit, anticorps G protein-coupled receptor kinase 4 L homeolog, anticorps G protein-coupled receptor kinase 4 S homeolog, anticorps GRK4, anticorps Grk4, anticorps AMPKalpha, anticorps grk4.L, anticorps grk4.S, anticorps grk4, anticorps LOC100540688

Sujet: GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling