FBXO8 anticorps (Middle Region)

N° du produit ABIN631700

Détail du produit anti-FBXO8 anticorps

Antigène: FBXO8 (F-Box Protein 8 (FBXO8))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO8 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO8 antibody was raised against the middle region of FBXO8

Purification: Affinity purified

Immunogène: FBXO8 antibody was raised using the middle region of FBXO8 corresponding to a region with amino acids EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO8 Blocking Peptide, catalog no. 33R-2402, is also available for use as a blocking control in assays to test for specificity of this FBXO8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO8

Antigène: FBXO8 (F-Box Protein 8 (FBXO8))

Autre désignation: FBXO8 (FBXO8 Produits)

Synonymes: anticorps FBXO8, anticorps T24I21.22, anticorps T24I21_22, anticorps zgc:136842, anticorps FBS, anticorps FBX8, anticorps Fbx8, anticorps F-box protein 8, anticorps F-box and associated interaction domains-containing protein, anticorps F-box protein 8 L homeolog, anticorps FBXO8, anticorps fbxo8, anticorps AT2G16810, anticorps fbxo8.L, anticorps Fbxo8

Sujet: FBXO8 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO8 belongs to the Fbxs class.

Poids moléculaire: 37 kDa (MW of target protein)