GNB2 anticorps

N° du produit ABIN631706

Détail du produit anti-GNB2 anticorps

Antigène: GNB2 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2 (GNB2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNB2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNB2 Blocking Peptide, catalog no. 33R-1656, is also available for use as a blocking control in assays to test for specificity of this GNB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNB2

Antigène: GNB2 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2 (GNB2))

Autre désignation: GNB2 (GNB2 Produits)

Synonymes: anticorps XGB1, anticorps XGbeta1, anticorps gnb2, anticorps Gnb-2, anticorps im:7138539, anticorps zgc:113357, anticorps guanine nucleotide binding protein (G protein), beta polypeptide 1, anticorps G protein subunit beta 2, anticorps guanine nucleotide binding protein (G protein), beta 2, anticorps guanine nucleotide binding protein (G protein), beta polypeptide 2, anticorps gnb1, anticorps GNB2, anticorps Gnb2, anticorps gnb2

Sujet: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB2 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction