RABGEF1 anticorps

N° du produit ABIN631729

Détail du produit anti-RABGEF1 anticorps

Antigène: RABGEF1 (RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABGEF1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABGEF1 Blocking Peptide, catalog no. 33R-6460, is also available for use as a blocking control in assays to test for specificity of this RABGEF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABGEF1

Antigène: RABGEF1 (RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1))

Autre désignation: RABGEF1 (RABGEF1 Produits)

Synonymes: anticorps Rab5ef, anticorps Rabex5, anticorps Rin2, anticorps RABEX5, anticorps rabex-5, anticorps rabgef1, anticorps RAB guanine nucleotide exchange factor (GEF) 1, anticorps RAB guanine nucleotide exchange factor 1, anticorps RAB guanine nucleotide exchange factor (GEF) 1 L homeolog, anticorps Rabgef1, anticorps RABGEF1, anticorps rabgef1.L

Sujet: RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process