UPP1 anticorps (Middle Region)
-
- Antigène Voir toutes UPP1 Anticorps
- UPP1 (Uridine Phosphorylase 1 (UPP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UPP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UPP1 antibody was raised against the middle region of UPP1
- Purification
- Affinity purified
- Immunogène
- UPP1 antibody was raised using the middle region of UPP1 corresponding to a region with amino acids ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
- Top Product
- Discover our top product UPP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UPP1 Blocking Peptide, catalog no. 33R-1068, is also available for use as a blocking control in assays to test for specificity of this UPP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UPP1 (Uridine Phosphorylase 1 (UPP1))
- Autre désignation
- UPP1 (UPP1 Produits)
- Synonymes
- anticorps upp1, anticorps UDRPASE, anticorps UP, anticorps UPASE, anticorps UPP, anticorps im:6911242, anticorps zgc:110755, anticorps AI325217, anticorps UPase, anticorps UdRPase, anticorps Up, anticorps Upp, anticorps uridine phosphorylase 1, anticorps uridine phosphorylase, anticorps upp1, anticorps NP_RS08675, anticorps Tsp_02326, anticorps UPP1, anticorps Upp1
- Sujet
- UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-