RNASE9 anticorps
-
- Antigène Voir toutes RNASE9 Anticorps
- RNASE9 (Ribonuclease, RNase A Family, 9 (Non-Active) (RNASE9))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNASE9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RNASE9 antibody was raised using a synthetic peptide corresponding to a region with amino acids PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH
- Top Product
- Discover our top product RNASE9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNASE9 Blocking Peptide, catalog no. 33R-7036, is also available for use as a blocking control in assays to test for specificity of this RNASE9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNASE9 (Ribonuclease, RNase A Family, 9 (Non-Active) (RNASE9))
- Autre désignation
- RNASE9 (RNASE9 Produits)
- Synonymes
- anticorps HEL128, anticorps h461, anticorps ESRL, anticorps ribonuclease A family member 9 (inactive), anticorps ribonuclease, RNase A family, 9 (non-active), anticorps RNASE9, anticorps Rnase9
- Sujet
- RNASE9 belongs to the pancreatic ribonuclease family. It may be involved in host defense.
- Poids moléculaire
- 24 kDa (MW of target protein)
-