CRBN anticorps (N-Term)
-
- Antigène Voir toutes CRBN Anticorps
- CRBN (Cereblon (CRBN))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRBN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRBN antibody was raised against the N terminal of CRBN
- Purification
- Affinity purified
- Immunogène
- CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
- Top Product
- Discover our top product CRBN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRBN Blocking Peptide, catalog no. 33R-2125, is also available for use as a blocking control in assays to test for specificity of this CRBN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRBN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRBN (Cereblon (CRBN))
- Autre désignation
- CRBN (CRBN Produits)
- Synonymes
- anticorps zgc:92404, anticorps mrt2a, anticorps F3N11.21, anticorps MRT2, anticorps MRT2A, anticorps 2610203G15Rik, anticorps 2900045O07Rik, anticorps AF229032, anticorps AW108261, anticorps piL, anticorps cereblon, anticorps ATP-dependent protease La (LON) domain protein, anticorps crbn, anticorps CRBN, anticorps AT2G25740, anticorps Crbn
- Sujet
- This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development.
- Poids moléculaire
- 50 kDa (MW of target protein)
-