Nodal anticorps

N° du produit ABIN631796

Détail du produit anti-Nodal anticorps

Antigène: Nodal (NODAL) (Nodal Homolog (NODAL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nodal est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NODAL Blocking Peptide, catalog no. 33R-7373, is also available for use as a blocking control in assays to test for specificity of this NODAL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NODAL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nodal

Antigène: Nodal (NODAL) (Nodal Homolog (NODAL))

Autre désignation: NODAL (NODAL Produits)

Synonymes: anticorps NODAL, anticorps Tg.413d, anticorps HTX5, anticorps nodal4, anticorps nodal4-A, anticorps nr4, anticorps xnr4, anticorps Xnr-1, anticorps nodal, anticorps nr1, anticorps nr1-A, anticorps nodal growth differentiation factor, anticorps nodal homolog (mouse), anticorps nodal, anticorps nodal growth differentiation factor L homeolog, anticorps nodal homolog 1 L homeolog, anticorps Nodal, anticorps NODAL, anticorps nodal.L, anticorps nodal1.L

Sujet: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Stem Cell Maintenance, Tube Formation, Positive Regulation of Endopeptidase Activity