KHDRBS2 anticorps (Middle Region)
-
- Antigène Voir toutes KHDRBS2 Anticorps
- KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KHDRBS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KHDRBS2 antibody was raised against the middle region of KHDRBS2
- Purification
- Affinity purified
- Immunogène
- KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG
- Top Product
- Discover our top product KHDRBS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KHDRBS2 Blocking Peptide, catalog no. 33R-2292, is also available for use as a blocking control in assays to test for specificity of this KHDRBS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KHDRBS2 (KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2))
- Autre désignation
- KHDRBS2 (KHDRBS2 Produits)
- Sujet
- KHDRBS2 is a RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection.
- Poids moléculaire
- 39 kDa (MW of target protein)
-