ALDH1B1 anticorps (Middle Region)
-
- Antigène Voir toutes ALDH1B1 Anticorps
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDH1 B1 antibody was raised against the middle region of ALDH1 1
- Purification
- Affinity purified
- Immunogène
- ALDH1 B1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
- Top Product
- Discover our top product ALDH1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDH1B1 Blocking Peptide, catalog no. 33R-3255, is also available for use as a blocking control in assays to test for specificity of this ALDH1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
- Autre désignation
- ALDH1B1 (ALDH1B1 Produits)
- Sujet
- ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
- Poids moléculaire
- 57 kDa (MW of target protein)
-