THOC6 anticorps

N° du produit ABIN631845

Détail du produit anti-THOC6 anticorps

Antigène: THOC6 (THO Complex 6 Homolog (THOC6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THOC6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THOC6 Blocking Peptide, catalog no. 33R-1196, is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THOC6

Antigène: THOC6 (THO Complex 6 Homolog (THOC6))

Autre désignation: THOC6 (THOC6 Produits)

Synonymes: anticorps WDR58, anticorps fSAP35, anticorps F830014G06Rik, anticorps Wdr58, anticorps Pdrp, anticorps zgc:101618, anticorps thoc6, anticorps THO complex 6, anticorps THO complex 6 homolog (Drosophila), anticorps THO complex 6 L homeolog, anticorps THOC6, anticorps Thoc6, anticorps thoc6, anticorps thoc6.L

Sujet: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.

Poids moléculaire: 37 kDa (MW of target protein)