ACTRT1 anticorps (Middle Region)

N° du produit ABIN631864

Détail du produit anti-ACTRT1 anticorps

Antigène: ACTRT1 (Actin-Related Protein T1 (ACTRT1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTRT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACTRT1 antibody was raised against the middle region of ACTRT1

Purification: Affinity purified

Immunogène: ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTRT1 Blocking Peptide, catalog no. 33R-2190, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTRT1

Antigène: ACTRT1 (Actin-Related Protein T1 (ACTRT1))

Autre désignation: ACTRT1 (ACTRT1 Produits)

Synonymes: anticorps 1700061J02Rik, anticorps Arp-T1, anticorps AIP1, anticorps ARIP1, anticorps ARPT1, anticorps HSD27, anticorps ACTRT1, anticorps actin-related protein T1, anticorps actin related protein T1, anticorps Actrt1, anticorps ACTRT1, anticorps LOC539271, anticorps LOC100344945, anticorps LOC100455523, anticorps LOC100472383, anticorps LOC100154405

Sujet: The specific function of ACTRT1 is not yet known.

Poids moléculaire: 42 kDa (MW of target protein)