ACTRT1 anticorps (Middle Region)
-
- Antigène Voir toutes ACTRT1 Anticorps
- ACTRT1 (Actin-Related Protein T1 (ACTRT1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTRT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACTRT1 antibody was raised against the middle region of ACTRT1
- Purification
- Affinity purified
- Immunogène
- ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
- Top Product
- Discover our top product ACTRT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACTRT1 Blocking Peptide, catalog no. 33R-2190, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACTRT1 (Actin-Related Protein T1 (ACTRT1))
- Autre désignation
- ACTRT1 (ACTRT1 Produits)
- Synonymes
- anticorps 1700061J02Rik, anticorps Arp-T1, anticorps AIP1, anticorps ARIP1, anticorps ARPT1, anticorps HSD27, anticorps ACTRT1, anticorps actin-related protein T1, anticorps actin related protein T1, anticorps Actrt1, anticorps ACTRT1, anticorps LOC539271, anticorps LOC100344945, anticorps LOC100455523, anticorps LOC100472383, anticorps LOC100154405
- Sujet
- The specific function of ACTRT1 is not yet known.
- Poids moléculaire
- 42 kDa (MW of target protein)
-