C21ORF45 anticorps (N-Term)

N° du produit ABIN631868

Détail du produit anti-C21ORF45 anticorps

Antigène: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C21ORF45 est non-conjugé

Application: Western Blotting (WB)

Specificité: C21 ORF45 antibody was raised against the N terminal Of C21 rf45

Purification: Affinity purified

Immunogène: C21 ORF45 antibody was raised using the N terminal Of C21 rf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF45 Blocking Peptide, catalog no. 33R-5672, is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C21ORF45

Antigène: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Autre désignation: C21ORF45 (MIS18A Produits)

Synonymes: anticorps B28, anticorps C21orf45, anticorps C21orf46, anticorps FASP1, anticorps MIS18alpha, anticorps hMis18alpha, anticorps 2610039C10Rik, anticorps 2810018N07Rik, anticorps RGD1310778, anticorps MIS18 kinetochore protein A, anticorps MIS18A, anticorps Mis18a

Sujet: C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Poids moléculaire: 26 kDa (MW of target protein)