CDKL2 anticorps

N° du produit ABIN631873

Détail du produit anti-CDKL2 anticorps

Antigène: CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDKL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDKL2 Blocking Peptide, catalog no. 33R-5933, is also available for use as a blocking control in assays to test for specificity of this CDKL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDKL2

Antigène: CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))

Autre désignation: CDKL2 (CDKL2 Produits)

Synonymes: anticorps KKIAMRE, anticorps P56, anticorps CDKL2, anticorps 5330436L21Rik, anticorps AI505225, anticorps Kkm, anticorps DKFZp459L235, anticorps kkiamre, anticorps cyclin dependent kinase like 2, anticorps cyclin-dependent kinase-like 2 (CDC2-related kinase), anticorps cyclin dependent kinase like 2 L homeolog, anticorps CDKL2, anticorps Cdkl2, anticorps cdkl2.L

Sujet: This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Poids moléculaire: 54 kDa (MW of target protein)