CDKL2 anticorps
-
- Antigène Voir toutes CDKL2 Anticorps
- CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDKL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR
- Top Product
- Discover our top product CDKL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDKL2 Blocking Peptide, catalog no. 33R-5933, is also available for use as a blocking control in assays to test for specificity of this CDKL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))
- Autre désignation
- CDKL2 (CDKL2 Produits)
- Synonymes
- anticorps KKIAMRE, anticorps P56, anticorps CDKL2, anticorps 5330436L21Rik, anticorps AI505225, anticorps Kkm, anticorps DKFZp459L235, anticorps kkiamre, anticorps cyclin dependent kinase like 2, anticorps cyclin-dependent kinase-like 2 (CDC2-related kinase), anticorps cyclin dependent kinase like 2 L homeolog, anticorps CDKL2, anticorps Cdkl2, anticorps cdkl2.L
- Sujet
- This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.
- Poids moléculaire
- 54 kDa (MW of target protein)
-