IQCE anticorps (Middle Region)
-
- Antigène Tous les produits IQCE
- IQCE (IQ Motif Containing E (IQCE))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IQCE est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IQCE antibody was raised against the middle region of IQCE
- Purification
- Affinity purified
- Immunogène
- IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IQCE Blocking Peptide, catalog no. 33R-4484, is also available for use as a blocking control in assays to test for specificity of this IQCE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IQCE (IQ Motif Containing E (IQCE))
- Autre désignation
- IQCE (IQCE Produits)
- Synonymes
- anticorps 1700028P05Rik, anticorps mKIAA1023, anticorps RGD1311349, anticorps IQ motif containing E, anticorps IQCE, anticorps Iqce
- Sujet
- IQCE contains 2 IQ domains. The functions of IQCE remain unknown.
- Poids moléculaire
- 77 kDa (MW of target protein)
-