IQCE anticorps (Middle Region)

N° du produit ABIN631892

Détail du produit anti-IQCE anticorps

Antigène: IQCE (IQ Motif Containing E (IQCE))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IQCE est non-conjugé

Application: Western Blotting (WB)

Specificité: IQCE antibody was raised against the middle region of IQCE

Purification: Affinity purified

Immunogène: IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IQCE Blocking Peptide, catalog no. 33R-4484, is also available for use as a blocking control in assays to test for specificity of this IQCE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IQCE

Antigène: IQCE (IQ Motif Containing E (IQCE))

Autre désignation: IQCE (IQCE Produits)

Synonymes: anticorps 1700028P05Rik, anticorps mKIAA1023, anticorps RGD1311349, anticorps IQ motif containing E, anticorps IQCE, anticorps Iqce

Sujet: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Poids moléculaire: 77 kDa (MW of target protein)