PAD4 anticorps (Middle Region)

N° du produit ABIN631895

Détail du produit anti-PAD4 anticorps

Antigène: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PADI4 antibody was raised against the middle region of PADI4

Purification: Affinity purified

Immunogène: PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAD4

Antigène: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Autre désignation: PADI4 (PADI4 Produits)

Synonymes: anticorps PAD, anticorps PAD4, anticorps PADI5, anticorps PDI4, anticorps PDI5, anticorps Pad4, anticorps Pdi4, anticorps peptidyl arginine deiminase 4, anticorps peptidyl arginine deiminase, type IV, anticorps PADI4, anticorps Padi4

Sujet: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Poids moléculaire: 74 kDa (MW of target protein)