GPR87 anticorps (Middle Region)

N° du produit ABIN631950

Détail du produit anti-GPR87 anticorps

Antigène: GPR87 (G Protein-Coupled Receptor 87 (GPR87))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPR87 est non-conjugé

Application: Western Blotting (WB)

Specificité: GPR87 antibody was raised against the middle region of GPR87

Purification: Affinity purified

Immunogène: GPR87 antibody was raised using the middle region of GPR87 corresponding to a region with amino acids NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPR87 Blocking Peptide, catalog no. 33R-6845, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR87 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPR87

Antigène: GPR87 (G Protein-Coupled Receptor 87 (GPR87))

Autre désignation: GPR87 (GPR87 Produits)

Synonymes: anticorps GPR95, anticorps KPG_002, anticorps G protein-coupled receptor 87, anticorps GPR87, anticorps Gpr87

Sujet: G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process