PSG6 anticorps (N-Term)

N° du produit ABIN631999

Détail du produit anti-PSG6 anticorps

Antigène: PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSG6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PSG6 antibody was raised against the N terminal of PSG6

Purification: Affinity purified

Immunogène: PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSG6

Antigène: PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))

Autre désignation: PSG6 (PSG6 Produits)

Synonymes: anticorps PSBG-10, anticorps PSBG-12, anticorps PSBG-6, anticorps PSG10, anticorps PSGGB, anticorps PSG6, anticorps PSG3, anticorps pregnancy specific beta-1-glycoprotein 6, anticorps pregnancy-specific beta-1-glycoprotein 4, anticorps PSG6, anticorps LOC456082

Sujet: PSG6 may have a role in modulation of the innate immune system.

Poids moléculaire: 47 kDa (MW of target protein)