TPD52L3 anticorps (Middle Region)

N° du produit ABIN632010

Détail du produit anti-TPD52L3 anticorps

Antigène: TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPD52L3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TPD52 L3 antibody was raised against the middle region of TPD52 3

Purification: Affinity purified

Immunogène: TPD52 L3 antibody was raised using the middle region of TPD52 3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD50 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPD52L3

Antigène: TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))

Autre désignation: TPD52L3 (TPD52L3 Produits)

Synonymes: anticorps NYDSP25, anticorps hD55, anticorps 4931412G03Rik, anticorps Trpd52l3, anticorps RGD1309391, anticorps TPD52L3, anticorps TRPD52L3, anticorps tumor protein D52 like 3, anticorps tumor protein D52-like 3, anticorps TPD52L3, anticorps Trpd52l3, anticorps Tpd52l3

Sujet: TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 15 kDa (MW of target protein)