CYP11B2 anticorps (Middle Region)
-
- Antigène Voir toutes CYP11B2 Anticorps
- CYP11B2 (Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP11B2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP11 B2 antibody was raised against the middle region of CYP11 2
- Purification
- Affinity purified
- Immunogène
- CYP11 B2 antibody was raised using the middle region of CYP11 2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
- Top Product
- Discover our top product CYP11B2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP11B2 Blocking Peptide, catalog no. 33R-8145, is also available for use as a blocking control in assays to test for specificity of this CYP11B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP11B2 (Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2))
- Autre désignation
- CYP11B2 (CYP11B2 Produits)
- Synonymes
- anticorps ALDOS, anticorps CPN2, anticorps CYP11B, anticorps CYP11BL, anticorps CYPXIB2, anticorps P-450C18, anticorps P450C18, anticorps P450aldo, anticorps Cpn2, anticorps Cyp11b, anticorps Cyp11b-2, anticorps Cp45as, anticorps Cyp11b3, anticorps RNCP45AS, anticorps cytochrome P450 family 11 subfamily B member 2, anticorps cytochrome P450, family 11, subfamily b, polypeptide 2, anticorps aldosterone synthase, anticorps cytochrome P450, family 11, subfamily B, polypeptide 2, anticorps cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2, anticorps CYP11B2, anticorps Cyp11b2
- Sujet
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process, Feeding Behaviour
-