MELK anticorps (Middle Region)
-
- Antigène Voir toutes MELK Anticorps
- MELK (Maternal Embryonic Leucine Zipper Kinase (MELK))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MELK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MELK antibody was raised against the middle region of MELK
- Purification
- Affinity purified
- Immunogène
- MELK antibody was raised using the middle region of MELK corresponding to a region with amino acids AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK
- Top Product
- Discover our top product MELK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MELK Blocking Peptide, catalog no. 33R-1602, is also available for use as a blocking control in assays to test for specificity of this MELK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MELK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MELK (Maternal Embryonic Leucine Zipper Kinase (MELK))
- Autre désignation
- MELK (MELK Produits)
- Synonymes
- anticorps MELK, anticorps xmelk, anticorps Melk, anticorps HPK38, anticorps AI327312, anticorps MPK38, anticorps mKIAA0175, anticorps fb71b01, anticorps fe01f04, anticorps wu:fb71b01, anticorps wu:fe01f04, anticorps maternal embryonic leucine zipper kinase, anticorps maternal embryonic leucine zipper kinase L homeolog, anticorps MELK, anticorps melk, anticorps cgd5_2270, anticorps Melk, anticorps melk.L
- Sujet
- The protein MELK phosphorylates ZNF622 and may contribute to its redirection to the nucleus. Also it may be involved in the inhibition of spliceosome assembly during mitosis.
- Poids moléculaire
- 75 kDa (MW of target protein)
-