-
- Antigène Voir toutes VPS53 Anticorps
- VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VPS53 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK
- Top Product
- Discover our top product VPS53 Anticorps primaire
-
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) (AA 111-140), (N-Term) antibody
VPS53 Reactivité: Humain, Souris WB, IHC (p), FACS Hôte: Lapin Polyclonal RB20279 unconjugated
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) antibodyVPS53 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) (AA 1-670) antibodyVPS53 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) (AA 431-480) antibodyVPS53 Reactivité: Humain, Souris, Rat, Lapin, Poisson zèbre (Danio rerio), Boeuf (Vache), Cheval, Hamster WB Hôte: Lapin Polyclonal unconjugated
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) (C-Term) antibodyVPS53 Reactivité: Humain, Souris, Rat WB, IF, EIA Hôte: Lapin Polyclonal unconjugated
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) (Middle Region) antibodyVPS53 Reactivité: Humain, Souris, Rat, Lapin, Poisson zèbre (Danio rerio), Boeuf (Vache), Cheval, Chien, Cobaye WB Hôte: Lapin Polyclonal unconjugated
anti-Vacuolar Protein Sorting 53 Homolog (VPS53) (N-Term) antibodyVPS53 Reactivité: Humain, Souris WB, EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VPS53 Blocking Peptide, catalog no. 33R-9919, is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS53 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))
- Autre désignation
- VPS53 (VPS53 Produits)
- Synonymes
- anticorps wu:fb77d11, anticorps zgc:103741, anticorps DKFZp469N152, anticorps 2010002A08Rik, anticorps 2310040I21Rik, anticorps 3100002B05Rik, anticorps Hccs1, anticorps HCCS1, anticorps hVps53L, anticorps pp13624, anticorps RGD1311391, anticorps VPS53, GARP complex subunit, anticorps vacuolar protein sorting 53 homolog (S. cerevisiae), anticorps vacuolar protein sorting 53, anticorps VPS53 GARP complex subunit, anticorps VPS53, anticorps vps53, anticorps PAAG_00802, anticorps MCYG_06020, anticorps VDBG_07188, anticorps MGYG_05943, anticorps Vps53
- Sujet
- This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.
- Poids moléculaire
- 92 kDa (MW of target protein)
-
Vous êtes ici:
