FBXO34 anticorps (Middle Region)

N° du produit ABIN632055

Détail du produit anti-FBXO34 anticorps

Antigène: FBXO34 (F-Box Protein 34 (FBXO34))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO34 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO34 antibody was raised against the middle region of FBXO34

Purification: Affinity purified

Immunogène: FBXO34 antibody was raised using the middle region of FBXO34 corresponding to a region with amino acids ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO34 Blocking Peptide, catalog no. 33R-2722, is also available for use as a blocking control in assays to test for specificity of this FBXO34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO34

Antigène: FBXO34 (F-Box Protein 34 (FBXO34))

Autre désignation: FBXO34 (FBXO34 Produits)

Synonymes: anticorps Fbx34, anticorps 2900057B08Rik, anticorps 5830426G16Rik, anticorps FBXO34, anticorps F-box protein 34, anticorps F-box protein 34 L homeolog, anticorps FBXO34, anticorps Fbxo34, anticorps fbxo34.L, anticorps fbxo34

Sujet: Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 79 kDa (MW of target protein)