FBXO34 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO34 Anticorps
- FBXO34 (F-Box Protein 34 (FBXO34))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO34 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO34 antibody was raised against the middle region of FBXO34
- Purification
- Affinity purified
- Immunogène
- FBXO34 antibody was raised using the middle region of FBXO34 corresponding to a region with amino acids ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP
- Top Product
- Discover our top product FBXO34 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO34 Blocking Peptide, catalog no. 33R-2722, is also available for use as a blocking control in assays to test for specificity of this FBXO34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO34 (F-Box Protein 34 (FBXO34))
- Autre désignation
- FBXO34 (FBXO34 Produits)
- Synonymes
- anticorps Fbx34, anticorps 2900057B08Rik, anticorps 5830426G16Rik, anticorps FBXO34, anticorps F-box protein 34, anticorps F-box protein 34 L homeolog, anticorps FBXO34, anticorps Fbxo34, anticorps fbxo34.L, anticorps fbxo34
- Sujet
- Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Poids moléculaire
- 79 kDa (MW of target protein)
-