F-Box Protein 34 (FBXO34) (Middle Region) anticorps

Détails pour le produit réf. ABIN632055, Fournisseur: Connectez-vous pour afficher
  • Fbx34
  • 2900057B08Rik
  • 5830426G16Rik
  • FBXO34
  • F-box protein 34
  • F-box protein 34 L homeolog
  • FBXO34
  • Fbxo34
  • fbxo34.L
  • fbxo34
Middle Region
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène FBXO34 antibody was raised using the middle region of FBXO34 corresponding to a region with amino acids ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP
Specificité FBXO34 antibody was raised against the middle region of FBXO34
Purification Affinity purified
Autre désignation FBXO34 (FBXO34 Antibody Extrait)
Sujet Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Poids moléculaire 79 kDa (MW of target protein)
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

FBXO34 Blocking Peptide, catalog no. 33R-2722, is also available for use as a blocking control in assays to test for specificity of this FBXO34 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO34 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images (Fournisseur)
Western Blotting (WB) image for anti-F-Box Protein 34 (FBXO34) (Middle Region) antibody (ABIN632055) FBXO34 antibody used at 1 ug/ml to detect target protein.