IPPK anticorps (Middle Region)

N° du produit ABIN632070

Détail du produit anti-IPPK anticorps

Antigène: IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IPPK est non-conjugé

Application: Western Blotting (WB)

Specificité: IPPK antibody was raised against the middle region of IPPK

Purification: Affinity purified

Immunogène: IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IPPK Blocking Peptide, catalog no. 33R-4685, is also available for use as a blocking control in assays to test for specificity of this IPPK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IPPK

Antigène: IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))

Autre désignation: IPPK (IPPK Produits)

Synonymes: anticorps IPPK, anticorps MGC146756, anticorps C9orf12, anticorps INSP5K2, anticorps IP5K, anticorps IPK1, anticorps bA476B13.1, anticorps 1810043M15Rik, anticorps InsP6, anticorps RGD1311271, anticorps rIpk1, anticorps ipk1, anticorps ipk1l, anticorps si:dkey-42i9.3, anticorps zgc:110769, anticorps ATIPK1, anticorps M40H3, anticorps MJB21.19, anticorps MJB21_19, anticorps inositol-pentakisphosphate 2-kinase 1, anticorps inositol-pentakisphosphate 2-kinase, anticorps inositol 1,3,4,5,6-pentakisphosphate 2-kinase, anticorps inositol pentakisphosphate 2-kinase, anticorps inositol-pentakisphosphate 2-kinase 1, anticorps IPPK, anticorps LOC521083, anticorps ippk, anticorps Ippk, anticorps IPK1

Sujet: IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.

Poids moléculaire: 56 kDa (MW of target protein)