ZGPAT anticorps (C-Term)
-
- Antigène Voir toutes ZGPAT Anticorps
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZGPAT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZGPAT antibody was raised against the C terminal of ZGPAT
- Purification
- Affinity purified
- Immunogène
- ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
- Top Product
- Discover our top product ZGPAT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZGPAT Blocking Peptide, catalog no. 33R-1217, is also available for use as a blocking control in assays to test for specificity of this ZGPAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZGPAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
- Autre désignation
- ZGPAT (ZGPAT Produits)
- Sujet
- ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-