ZGPAT anticorps (C-Term)

N° du produit ABIN632083

Détail du produit anti-ZGPAT anticorps

Antigène: ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZGPAT est non-conjugé

Application: Western Blotting (WB)

Specificité: ZGPAT antibody was raised against the C terminal of ZGPAT

Purification: Affinity purified

Immunogène: ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZGPAT Blocking Peptide, catalog no. 33R-1217, is also available for use as a blocking control in assays to test for specificity of this ZGPAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZGPAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZGPAT

Antigène: ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))

Autre désignation: ZGPAT (ZGPAT Produits)

Sujet: ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway