ACTR3B anticorps
-
- Antigène Voir toutes ACTR3B Anticorps
- ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTR3B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
- Top Product
- Discover our top product ACTR3B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACTR3B Blocking Peptide, catalog no. 33R-1986, is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))
- Autre désignation
- ACTR3B (ACTR3B Produits)
- Synonymes
- anticorps RGD1565759, anticorps ARP11, anticorps ARP3BETA, anticorps 9630005C02, anticorps AW047569, anticorps Arp3b, anticorps Arp3beta, anticorps ARP3 actin related protein 3 homolog B, anticorps ARP3 actin-related protein 3B, anticorps Actr3b, anticorps ACTR3B
- Sujet
- ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-