AP3M2 anticorps (Middle Region)

N° du produit ABIN632155

Détail du produit anti-AP3M2 anticorps

Antigène: AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AP3M2 est non-conjugé

Application: Western Blotting (WB)

Specificité: AP3 M2 antibody was raised against the middle region of AP3 2

Purification: Affinity purified

Immunogène: AP3 M2 antibody was raised using the middle region of AP3 2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AP3M2 Blocking Peptide, catalog no. 33R-9888, is also available for use as a blocking control in assays to test for specificity of this AP3M2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AP3M2

Antigène: AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))

Autre désignation: AP3M2 (AP3M2 Produits)

Synonymes: anticorps wu:fc15g12, anticorps zgc:86670, anticorps AP47B, anticorps CLA20, anticorps P47B, anticorps 5830445E16Rik, anticorps AP-3B, anticorps adaptor related protein complex 3 mu 2 subunit, anticorps AP-3 complex subunit mu-2, anticorps adaptor-related protein complex 3, mu 2 subunit, anticorps adaptor related protein complex 3 mu 2 subunit S homeolog, anticorps AP3M2, anticorps ap3m2, anticorps LOC582979, anticorps ap3m2.S, anticorps Ap3m2

Sujet: AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Poids moléculaire: 47 kDa (MW of target protein)