FBXO42 anticorps (Middle Region)

N° du produit ABIN632175

Détail du produit anti-FBXO42 anticorps

Antigène: FBXO42 (F-Box Protein 42 (FBXO42))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO42 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO42 antibody was raised against the middle region of FBXO42

Purification: Affinity purified

Immunogène: FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO42 Blocking Peptide, catalog no. 33R-8199, is also available for use as a blocking control in assays to test for specificity of this FBXO42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO42

Antigène: FBXO42 (F-Box Protein 42 (FBXO42))

Autre désignation: FBXO42 (FBXO42 Produits)

Synonymes: anticorps Fbx42, anticorps JFK, anticorps 6720460I06Rik, anticorps mKIAA1332, anticorps zgc:64224, anticorps wu:fj14e08, anticorps MGC84191, anticorps FBXO42, anticorps F-box protein 42, anticorps F-box protein 42 L homeolog, anticorps FBXO42, anticorps Fbxo42, anticorps fbxo42, anticorps fbxo42.L

Sujet: Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 78 kDa (MW of target protein)