CCDC25 anticorps (Middle Region)

N° du produit ABIN632195

Détail du produit anti-CCDC25 anticorps

Antigène: CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC25 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC25 antibody was raised against the middle region of CCDC25

Purification: Affinity purified

Immunogène: CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC25 Blocking Peptide, catalog no. 33R-2035, is also available for use as a blocking control in assays to test for specificity of this CCDC25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC25

Antigène: CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))

Autre désignation: CCDC25 (CCDC25 Produits)

Synonymes: anticorps 2610528H13Rik, anticorps NSrp70, anticorps RGD1307689, anticorps coiled-coil domain containing 25, anticorps CCDC25, anticorps Ccdc25

Sujet: The function of CCDC25 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 24 kDa (MW of target protein)