RRAGD anticorps (Middle Region)

N° du produit ABIN632202

Détail du produit anti-RRAGD anticorps

Antigène: RRAGD (Ras-Related GTP Binding D (RRAGD))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRAGD est non-conjugé

Application: Western Blotting (WB)

Specificité: RRAGD antibody was raised against the middle region of RRAGD

Purification: Affinity purified

Immunogène: RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRAGD Blocking Peptide, catalog no. 33R-1669, is also available for use as a blocking control in assays to test for specificity of this RRAGD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RRAGD

Antigène: RRAGD (Ras-Related GTP Binding D (RRAGD))

Autre désignation: RRAGD (RRAGD Produits)

Synonymes: anticorps RAGD, anticorps bA11D8.2.1, anticorps 5730543C08Rik, anticorps AI467523, anticorps C030003H22Rik, anticorps D4Ertd174e, anticorps Ras related GTP binding D, anticorps Ras-related GTP binding D, anticorps RRAGD, anticorps Rragd

Sujet: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Poids moléculaire: 45 kDa (MW of target protein)