GNGT2 anticorps (Middle Region)
-
- Antigène Voir toutes GNGT2 Anticorps
- GNGT2 (Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNGT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GNGT2 antibody was raised against the middle region of Gngt2
- Purification
- Affinity purified
- Immunogène
- GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
- Top Product
- Discover our top product GNGT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNGT2 Blocking Peptide, catalog no. 33R-4362, is also available for use as a blocking control in assays to test for specificity of this GNGT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNGT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNGT2 (Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2))
- Autre désignation
- GNGT2 (GNGT2 Produits)
- Synonymes
- anticorps G-GAMMA-8, anticorps G-GAMMA-C, anticorps GNG8, anticorps GNG9, anticorps GNGT8, anticorps AV096488, anticorps gngt2, anticorps id:ibd1139, anticorps wu:fk53d05, anticorps G protein subunit gamma transducin 2, anticorps guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2, anticorps guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2a, anticorps GNGT2, anticorps Gngt2, anticorps gngt2a
- Sujet
- Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.
- Poids moléculaire
- 8 kDa (MW of target protein)
-