SRRD anticorps (Middle Region)

N° du produit ABIN632241

Détail du produit anti-SRRD anticorps

Antigène: SRRD (SRR1 Domain Containing (SRRD))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRRD est non-conjugé

Application: Western Blotting (WB)

Specificité: SRRD antibody was raised against the middle region of SRRD

Purification: Affinity purified

Immunogène: SRRD antibody was raised using the middle region of SRRD corresponding to a region with amino acids DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRRD Blocking Peptide, catalog no. 33R-1995, is also available for use as a blocking control in assays to test for specificity of this SRRD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRRD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRRD

Antigène: SRRD (SRR1 Domain Containing (SRRD))

Autre désignation: SRRD (SRRD Produits)

Synonymes: anticorps HC/HCC, anticorps SRR1L, anticorps 2810002G02Rik, anticorps Srr1, anticorps SRR1 domain containing, anticorps SRRD, anticorps Srrd

Sujet: SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.

Poids moléculaire: 38 kDa (MW of target protein)