SRRD anticorps (Middle Region)
-
- Antigène Voir toutes SRRD Anticorps
- SRRD (SRR1 Domain Containing (SRRD))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRRD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SRRD antibody was raised against the middle region of SRRD
- Purification
- Affinity purified
- Immunogène
- SRRD antibody was raised using the middle region of SRRD corresponding to a region with amino acids DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA
- Top Product
- Discover our top product SRRD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SRRD Blocking Peptide, catalog no. 33R-1995, is also available for use as a blocking control in assays to test for specificity of this SRRD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRRD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRRD (SRR1 Domain Containing (SRRD))
- Autre désignation
- SRRD (SRRD Produits)
- Synonymes
- anticorps HC/HCC, anticorps SRR1L, anticorps 2810002G02Rik, anticorps Srr1, anticorps SRR1 domain containing, anticorps SRRD, anticorps Srrd
- Sujet
- SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.
- Poids moléculaire
- 38 kDa (MW of target protein)
-