MYL9 anticorps (Middle Region)

N° du produit ABIN632242

Détail du produit anti-MYL9 anticorps

Antigène: MYL9 (Myosin Regulatory Light Chain 2, Smooth Muscle Isoform (MYL9))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYL9 est non-conjugé

Application: Western Blotting (WB)

Specificité: MYL9 antibody was raised against the middle region of MYL9

Purification: Affinity purified

Immunogène: MYL9 antibody was raised using the middle region of MYL9 corresponding to a region with amino acids FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYL9 Blocking Peptide, catalog no. 33R-2863, is also available for use as a blocking control in assays to test for specificity of this MYL9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYL9

Antigène: MYL9 (Myosin Regulatory Light Chain 2, Smooth Muscle Isoform (MYL9))

Autre désignation: MYL9 (MYL9 Produits)

Synonymes: anticorps LC20, anticorps MLC-2C, anticorps MLC2, anticorps MRLC1, anticorps MYRL2, anticorps AI327049, anticorps MLC20, anticorps Mylc2c, anticorps RLC-C, anticorps myosin, anticorps regulatory, anticorps MRCL3, anticorps MRLC2, anticorps MYL9, anticorps zgc:103467, anticorps myl9, anticorps zgc:77916, anticorps myosin light chain 9, anticorps myosin, light polypeptide 9, regulatory, anticorps myosin light chain 9 L homeolog, anticorps myosin, light chain 9, regulatory, anticorps myosin, light chain 12A, regulatory, non-sarcomeric, anticorps myosin, light chain 9a, regulatory, anticorps myosin, light chain 9b, regulatory, anticorps MYL9, anticorps Myl9, anticorps myl9.L, anticorps MYL12A, anticorps myl9a, anticorps myl9b

Sujet: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains.

Poids moléculaire: 20 kDa (MW of target protein)