PRKAB1 anticorps (N-Term)

N° du produit ABIN632268

Détail du produit anti-PRKAB1 anticorps

Antigène: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKAB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKAB1 antibody was raised against the N terminal of PRKAB1

Purification: Affinity purified

Immunogène: PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKAB1 Blocking Peptide, catalog no. 33R-4439, is also available for use as a blocking control in assays to test for specificity of this PRKAB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKAB1

Antigène: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Autre désignation: PRKAB1 (PRKAB1 Produits)

Synonymes: anticorps AMPK, anticorps HAMPKb, anticorps 1300015D22Rik, anticorps AU021155, anticorps E430008F22, anticorps MGC82489, anticorps prkab1, anticorps wu:fk93d05, anticorps wu:fw87e09, anticorps zgc:56652, anticorps zgc:76975, anticorps zgc:92228, anticorps protein kinase AMP-activated non-catalytic subunit beta 1, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit, b, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit, a, anticorps PRKAB1, anticorps Prkab1, anticorps prkab1.S, anticorps prkab1, anticorps prkab1b, anticorps prkab1a

Sujet: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: AMPK Signaling, L'effet Warburg