RGS5 anticorps (Middle Region)

N° du produit ABIN632273

Détail du produit anti-RGS5 anticorps

Antigène: RGS5 (Regulator of G-Protein Signaling 5 (RGS5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS5 est non-conjugé

Application: Western Blotting (WB)

Specificité: RGS5 antibody was raised against the middle region of RGS5

Purification: Affinity purified

Immunogène: RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS5 Blocking Peptide, catalog no. 33R-7114, is also available for use as a blocking control in assays to test for specificity of this RGS5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS5

Antigène: RGS5 (Regulator of G-Protein Signaling 5 (RGS5))

Autre désignation: RGS5 (RGS5 Produits)

Synonymes: anticorps MST092, anticorps MST106, anticorps MST129, anticorps MSTP032, anticorps MSTP092, anticorps MSTP106, anticorps MSTP129, anticorps RGS5, anticorps 1110070A02Rik, anticorps fj30h05, anticorps rgs5, anticorps wu:fj30h05, anticorps zgc:64006, anticorps xrgs5, anticorps MGC147439, anticorps zgc:110206, anticorps regulator of G protein signaling 5, anticorps regulator of G-protein signaling 5, anticorps regulator of G protein signaling 5a, anticorps regulator of G-protein signaling 5 L homeolog, anticorps regulator of G protein signaling 5b, anticorps RGS5, anticorps Rgs5, anticorps rgs5a, anticorps rgs5, anticorps rgs5.L, anticorps rgs5b

Sujet: The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling