ALKBH3 anticorps

N° du produit ABIN632277

Détail du produit anti-ALKBH3 anticorps

Antigène: ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALKBH3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALKBH3 Blocking Peptide, catalog no. 33R-2593, is also available for use as a blocking control in assays to test for specificity of this ALKBH3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALKBH3

Antigène: ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))

Autre désignation: ALKBH3 (ALKBH3 Produits)

Synonymes: anticorps ABH3, anticorps DEPC-1, anticorps DEPC1, anticorps PCA1, anticorps 1700108H04Rik, anticorps 1810020C19Rik, anticorps Abh3, anticorps mABH3, anticorps alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase L homeolog, anticorps alkB homolog 3, alpha-ketoglutaratedependent dioxygenase, anticorps alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase, anticorps alkbh3.L, anticorps ALKBH3, anticorps Alkbh3

Sujet: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Réparation de l'ADN